Protein Info for Psest_3877 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 45 to 64 (20 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details amino acids 209 to 240 (32 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details amino acids 415 to 436 (22 residues), see Phobius details amino acids 477 to 496 (20 residues), see Phobius details amino acids 508 to 534 (27 residues), see Phobius details amino acids 546 to 569 (24 residues), see Phobius details PF03169: OPT" amino acids 12 to 282 (271 residues), 165.5 bits, see alignment E=1.1e-52 amino acids 302 to 567 (266 residues), 160 bits, see alignment E=5e-51

Best Hits

KEGG orthology group: None (inferred from 88% identity to psa:PST_0395)

Predicted SEED Role

"Oligopeptide transporter, OPT family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRD0 at UniProt or InterPro

Protein Sequence (571 amino acids)

>Psest_3877 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MIATNLAVSPRELTARALLTGLLLGALLAPSNVYSGLKIGWSFNMSIIALLIGFAFWQSM
SVAFGRPRWSLLESNINQTTASSCASIISGGLVAPIPAYTLLTGQQLDSLPLMAWVFSVS
FLGIWVAWYLRPSLIVESGLRFPEGMATLATLQQIYSHGAEAGRRLWVLGSAALLAAASK
LIDAFFWTLPRWAPSAQLERLTFSFEPSLLLLGFGGIIGLRVGLSLLLGAVLAWGLIAPW
LLAEGLVRLPAGAQGPQFALLIEWLLWPGVSLMVCATLTSLGLRLLRSRSSAVPRQPKSR
RPNGWPIGGFVLAVLLVLVLQVSLFGIDLWLALLSIPLALMLAMVAARVVGATGIPPIGA
IGQLSQLGFGVFAPGQVPVNLMSANTAGGAAGQCTDLLNDFKVGHVIGAAPGRQAVAQCC
GILLGSVVGVLAYQLLIPNPQSMLITPEWPAPAVATWKAVAEALTGGLGALAADVRWAML
AGALCGVLLGTLEGLLPERRLRWLPSSAALGLAFIIPASISLMMTLGAVLAWAFASRWRS
LGERFVIVAAAGLVAGESMAGVGASLWQLLR