Protein Info for PGA1_262p02060 in Phaeobacter inhibens DSM 17395

Annotation: transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 PF02796: HTH_7" amino acids 13 to 38 (26 residues), 25.3 bits, see alignment (E = 1.4e-09) PF22483: Mu-transpos_C_2" amino acids 306 to 371 (66 residues), 58.8 bits, see alignment E=3.5e-20

Best Hits

Swiss-Prot: 69% identical to TRAT_AMIAI: Transposase (nmoT) from Aminobacter aminovorans

KEGG orthology group: None (inferred from 73% identity to npp:PP1Y_Lpl1338)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (509 amino acids)

>PGA1_262p02060 transposase (Phaeobacter inhibens DSM 17395)
MGFLSVIRRWALRDKMPIREIARRTGLSRNTIKKYLREGAVEPQFKTPKRPSKLDPYADR
LSAWLLIQTRKSRKERRTVKQMHADLVKLGYDGSYERVAAFARAWREDWHRAEQTTGRGT
YVPLVFAPGEAFQFDWSEDWANIGGERVKLQVAHIKLSHSRAFLVRAYPLQTHEMLFDAH
WHAFRVFGGVPGRGIYDNMRTAVDRVGKGKQRDVNARFKAMASHYVFEPEFCNPAAGWEK
GQVEKNVQDARNRMWQVMPVCADLAELNQWLEDRCIALWTETPHKVLPGSIADVWEAEKP
TLMALPPAFDGFIEHSKRVSPTCLITFERNRYSVPASFANRRISLHVYPERLVIVAEGQT
VCEHARIIERSHRKPGKVIYDWRHYLAVIQRKPGALRNGAPFTEMPDAFRQLQYHMLRKE
GGDREMVDVLSLVLQHNEEDILCAVELALEAGVPTKTHILNLLHRLIDRKPTDHPEVDPP
DVLALQTTPEANVDRYDGLRQAGGKRHAS