Protein Info for HP15_3738 in Marinobacter adhaerens HP15

Annotation: histidinol-phosphate phosphatase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01662: HAD hydrolase, family IIIA
  • amino acids 2 to 146 (145 residues), 111 bits, E=4.9e-36
• TIGR01656: histidinol-phosphate phosphatase domain
  • amino acids 2 to 144 (143 residues), 128.8 bits, E=1.6e-41
• PF00702: Hydrolase
  • amino acids 15 to 136 (122 residues), 27.1 bits, E=1e-09
• PF08645: PNK3P
  • amino acids 22 to 127 (106 residues), 26.8 bits, E=7.8e-10
• PF13242: Hydrolase_like
  • amino acids 98 to 156 (59 residues), 42.8 bits, E=8.4e-15

Best Hits

Swiss-Prot: 58% identical to GMHBB_PSEAE: D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (gmhB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 55% identity to psa:PST_0008)

Predicted SEED Role

"D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase (EC 3.1.1.-); Histidinol-phosphatase (EC 3.1.3.15)" (EC 3.1.1.-, EC 3.1.3.15)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Alkaloid biosynthesis II
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Ether lipid metabolism
• Fructose and mannose metabolism
• Glycerophospholipid metabolism
• Histidine metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Retinol metabolism
• Riboflavin metabolism
• Sphingolipid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-, 3.1.3.-, 3.1.3.15

Use Curated BLAST to search for 3.1.1.- or 3.1.3.- or 3.1.3.15

Sequence Analysis Tools

See E4PI16 at UniProt or InterPro

Protein Sequence (185 amino acids)

>HP15_3738 histidinol-phosphate phosphatase family protein (Marinobacter adhaerens HP15)
MLIILDRDGVINEYDGNYICSADEWHPIPGSVEAVARLCIAGHRIAIATNQSGIGRGYYD
TDELDAMHEKLEQLVEAQGGCIDFIAYCPHHPDDQCCCRKPLTGLLEQIREHFHLASLEG
VIMVGDSRKDLEAGHAEGCRPVLVRTGNGLDTERHLDARPIPGADVSIYDNLSKFTDALL
SAEGW