Protein Info for HP15_3731 in Marinobacter adhaerens HP15

Annotation: sulfide-quinone reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 36% identical to SQOR_HUMAN: Sulfide:quinone oxidoreductase, mitochondrial (SQOR) from Homo sapiens

KEGG orthology group: None (inferred from 78% identity to maq:Maqu_0378)

MetaCyc: 62% identical to sulfide:quinone oxidoreductase (Pseudomonas putida KT2440)
R17-RXN [EC: 1.8.5.4]

Predicted SEED Role

"FIG003847: Oxidoreductase (flavoprotein)"

MetaCyc Pathways

sulfide oxidation I (to sulfur globules) (1/1 steps found)
sulfide oxidation III (to sulfite) (3/4 steps found)
superpathway of sulfide oxidation (Starkeya novella) (3/5 steps found)
superpathway of sulfide oxidation (Acidithiobacillus ferrooxidans) (6/10 steps found)
superpathway of sulfide oxidation (phototrophic sulfur bacteria) (5/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PI09 at UniProt or InterPro

Protein Sequence (422 amino acids)

>HP15_3731 sulfide-quinone reductase (Marinobacter adhaerens HP15)
MTSNTTTTGSVKTHTVVIVGGGAAGISVASSIHKRDGNIDIAIIEPATRHHYQPGWTMVG
GGVFRPEVTSKPMSEVMPKFVSWYQQPVTAIDQDNNQVSLADGSSVQYKALVLAPGLELN
WGGIDGLEEALGSNGVTSNYREGMASYTWDMVQKLKKGRALFSQPPMPIKCAGAPQKAMY
LSADYWLKHGVLNNVDIQFHNAGAVLFGVADYVPALEAYVEKYGIDLNFQSTLVAVNGPA
KTAVFRSTDGDGNTEDREVSFDMLHAVPPQRAPKLIRESALANEAGWLDLEDDTLRHKTY
ANIFGLGDASGTGNAKTAAAVRKQAPVVAENLVATLRNQPLEAAYLGYGSCPLTVENGKI
VLAEFGYGGVLQPSFPKWINDGTKATRAAWWLKAKQLPTLYWHGMLKGHEWLARPAVRSP
QK