Protein Info for HP15_3730 in Marinobacter adhaerens HP15

Annotation: methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 transmembrane" amino acids 150 to 168 (19 residues), see Phobius details amino acids 174 to 190 (17 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 15 to 112 (98 residues), 52.7 bits, see alignment E=2.4e-18 PF00989: PAS" amino acids 21 to 107 (87 residues), 43.6 bits, see alignment E=7e-15 PF08448: PAS_4" amino acids 24 to 111 (88 residues), 23.6 bits, see alignment E=1.3e-08 PF13426: PAS_9" amino acids 24 to 110 (87 residues), 37.9 bits, see alignment E=4.7e-13 PF08447: PAS_3" amino acids 32 to 114 (83 residues), 66.6 bits, see alignment E=5e-22 PF00015: MCPsignal" amino acids 303 to 484 (182 residues), 143.1 bits, see alignment E=2.1e-45

Best Hits

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PI08 at UniProt or InterPro

Protein Sequence (517 amino acids)

>HP15_3730 methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor (Marinobacter adhaerens HP15)
MRKNLPVTDNEKTFPSNQKLISSTDLKGKIRHCNSAFVEVSGFSRDELIGQPHNIVRHPD
MPPAAYENMWSHLKAGQPWMGLVKNRCKNGDYYWVSAYVTPVTENGKVVGYESVRSCPDR
QDVARAEKLYADIRSGNSGIRFWQRFQPPTLFLAFVFIVAGILFIAGQKMFSELSLAVGV
IIYAGWMHVARKQLMASVTQLLEHSFTDDLAAKSYTDDELPLGRIKVAVKAQQAHLDAVL
TRLEDSADEMRLFSVKGREVTFEAQEALRQQQAETEQVAAAVHEMSQTIAEVSSNVQSTA
ERADSAKEFANEGRSVVRGTREAIETLKGSVHSISDSVGELSQQTQQIASAAKIIEEIAE
QTNLLALNAAIEAARAGEHGRGFAVVAEEVRGLASRTRNSTSEIHGIVNALISRSEDANR
KADEGKLSADEGMEKMLSAESTLNDIAESVTNIAEMALQMAAAVEEQAQVSDQINEQVEK
ISDLASNNLSKGEESTDCVKNIEQIANDLHELVVRFK