Protein Info for Psest_3856 in Pseudomonas stutzeri RCH2

Annotation: ABC-type branched-chain amino acid transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 46 to 73 (28 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 217 to 242 (26 residues), see Phobius details amino acids 254 to 276 (23 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 41 to 299 (259 residues), 124.8 bits, see alignment E=1.9e-40

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 98% identity to psa:PST_0416)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQP7 at UniProt or InterPro

Protein Sequence (328 amino acids)

>Psest_3856 ABC-type branched-chain amino acid transport system, permease component (Pseudomonas stutzeri RCH2)
MNSQLSVTPATKRPLLRLETVLILIGVIALALAPFYFYPIFLMKVLCFALFACAFNLLLG
YTGILSFGHAAFFGGAAYFTAHAVKEWGLTPELGILVGVAGAAFLGLIIGFLAIRRQGIY
STMITLALSQMFFFFCLQASFTHGEDGIQNIPRGHLFGLIDLEEPLYMYFFVLSVFLAGM
LLIWRVIHSPYGMILRSIRENENRAISLGYSVSRYKLGAFVMSAALAGLAGGLKALVFQF
ATLTDVSWQMSGEVVLMTLLGGIGTLVGPVFGAALVTTLGNYFATSELPVTLVTGIIFMV
CVLVFRRGMIGELYASRLGKKLERRADD