Protein Info for HP15_3727 in Marinobacter adhaerens HP15

Annotation: diguanylate cyclase (GGDEF domain)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 TIGR00229: PAS domain S-box protein" amino acids 5 to 130 (126 residues), 35.4 bits, see alignment E=1.1e-12 PF08447: PAS_3" amino acids 31 to 118 (88 residues), 65.5 bits, see alignment E=8.6e-22 amino acids 159 to 238 (80 residues), 44.5 bits, see alignment E=3e-15 PF14598: PAS_11" amino acids 39 to 120 (82 residues), 29.3 bits, see alignment E=1.4e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 256 to 424 (169 residues), 167.8 bits, see alignment E=1.7e-53 PF00990: GGDEF" amino acids 261 to 421 (161 residues), 148.1 bits, see alignment E=4e-47

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PI05 at UniProt or InterPro

Protein Sequence (429 amino acids)

>HP15_3727 diguanylate cyclase (GGDEF domain) (Marinobacter adhaerens HP15)
MHLTAETRLNAILDGTGAGTWEYNLDTGEIIFNERWATMLGYTLEELSPLSFQTWEKLSH
PTDIESANQALTAYLSGDAHQFECVVRMLHKDGDWRYIHTRGTLFNNDQTAESRWLMGTH
LDVTREKLSQHQMEQLAKSLPGIIYTFVLEPGGRYFFSYLSEKTWDFYGLTAEECLDDPD
KIFNLIHPDDLPRVHESIAVSAQTLDEWVCEYRVQTERGTYWLKGVSRPEKDADGRISWH
GMTINIDTEKNLELELEQLSITDELTGLYNRRYMLRKLQESVAQGERYGDTFSLISLDID
FFKTINDSYGHPTGDAVLQRFADIIESRTRKSDIVARTGGEEFIIFMPNTGLSEAGHVAE
SLRIALQTESFVSDEGETFGTTFSAGVVNWSGAESQTTSVRDLLSACDQSMYAAKRAGRN
RVVANGNGE