Protein Info for PGA1_262p01860 in Phaeobacter inhibens DSM 17395

Annotation: putative acyl-Co-A dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 PF02771: Acyl-CoA_dh_N" amino acids 84 to 162 (79 residues), 47.5 bits, see alignment E=4.3e-16 PF02770: Acyl-CoA_dh_M" amino acids 167 to 276 (110 residues), 48.1 bits, see alignment E=2.1e-16 PF00441: Acyl-CoA_dh_1" amino acids 286 to 447 (162 residues), 79.2 bits, see alignment E=7.8e-26 PF12806: Acyl-CoA_dh_C" amino acids 470 to 586 (117 residues), 97.4 bits, see alignment E=1.4e-31

Best Hits

Swiss-Prot: 69% identical to DMDC_RUEPO: 3-methylmercaptopropionyl-CoA dehydrogenase (dmdC) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: None (inferred from 69% identity to sil:SPO3804)

MetaCyc: 69% identical to 3-(methylsulfanyl)propanoyl-CoA dehydrogenase monomer (Ruegeria pomeroyi DSS-3)
RXN-12572 [EC: 1.3.99.41]

Predicted SEED Role

"3-methylmercaptopropionyl-CoA dehydrogenase (DmdC)"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.99.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F2I6 at UniProt or InterPro

Protein Sequence (592 amino acids)

>PGA1_262p01860 putative acyl-Co-A dehydrogenase (Phaeobacter inhibens DSM 17395)
MRRAADMAYQAPIRDIMFNLEHLSAWPQVTSLPTYDGIEASDAEAALEGFGRFCTEIIEP
LSAVGDTVGARFDGVKVAMPASFEQAYTQFVDMGWQSLSHPAEHGGMGLPRAVGAAATEI
LNAADMSFGLCPLLTDGAIDALLLSGSEEQKARYLEPMITGQWSGTMNLTEPQAGSDLGR
VRCKAERCDDGSFAITGTKIFITYGEHDLSENIIHLVLARTPDAPAGPKGLSLFIVPKYM
VQNDGSLGARNAVNCVSIEHKMGVRASPTAVLEFDAAKGFLVGEENRGLEYMFVMMTSAR
FSVGVQGVAVSERALQHALAFAQERQQGRPVDGSTKDAVSINQHPDVRRMLLRMRGMVEG
GRALALATAGWLDLAHSGDEQANAMAEFLVPLVKGNCSERSVEVTSLGLQIHGGMGFIEE
TGVAQLCRDARILPIYEGTTAIQANDLLGRKVLRDGGETARRFSALIAETEDQLNSDCPQ
SRMIAERLSQARTAFDASLSWLLETAPTDPNAAFAGGVPFLMLTGNLAVGWQFGRAALVA
RAQLERGEDAAFMSEKIATACFYAQHILVECAAERVRIIEGSDCLFAPTLQT