Protein Info for Psest_3843 in Pseudomonas stutzeri RCH2

Annotation: 4-hydroxybenzoate synthetase (chorismate lyase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04345: Chor_lyase
  • amino acids 12 to 180 (169 residues), 176.2 bits, E=2.3e-56

Best Hits

Swiss-Prot: 64% identical to UBIC_PSEAE: Probable chorismate pyruvate-lyase (ubiC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03181, chorismate--pyruvate lyase [EC: 4.1.3.40] (inferred from 94% identity to psa:PST_0429)

Predicted SEED Role

"Chorismate--pyruvate lyase (EC 4.1.3.40)" in subsystem Ubiquinone Biosynthesis (EC 4.1.3.40)

MetaCyc Pathways

• superpathway of chorismate metabolism (44/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
• 4-hydroxybenzoate biosynthesis II (bacteria) (1/1 steps found)
• polybrominated phenols biosynthesis (1/4 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (4/9 steps found)
• spongiadioxin C biosynthesis (1/7 steps found)
• polybrominated dihydroxylated diphenyl ethers biosynthesis (1/8 steps found)
• p-HBAD biosynthesis (1/9 steps found)
• tetrahydromethanopterin biosynthesis (3/14 steps found)
• superpathway of polybrominated aromatic compound biosynthesis (2/20 steps found)
• phenolphthiocerol biosynthesis (1/23 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.40

Sequence Analysis Tools

See L0GNI4 at UniProt or InterPro

Protein Sequence (184 amino acids)

>Psest_3843 4-hydroxybenzoate synthetase (chorismate lyase) (Pseudomonas stutzeri RCH2)
MPERAVSEFLDWLTADRLPSPLDPALHDWLYVDKGSLTRRLTELADGAFSVKPLHEAWQP
LRADECAALGVPAESEGWVREVYLCGHGQPWVFARSVAARAQLEESGLDLQRLGNRSLGE
LLFSDPAFARGTLEACHYPARGLPDACRVDGLWARRSCFRQNRLGVLVAEVFLPELWQAA
AVTP