Protein Info for HP15_366 in Marinobacter adhaerens HP15

Annotation: translation elongation factor Tu

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF00009: GTP_EFTU" amino acids 1 to 193 (193 residues), 208 bits, see alignment E=1.5e-65 TIGR00231: small GTP-binding protein domain" amino acids 1 to 135 (135 residues), 49.8 bits, see alignment E=3.2e-17 TIGR00485: translation elongation factor Tu" amino acids 1 to 386 (386 residues), 726.5 bits, see alignment E=6.5e-223 PF03144: GTP_EFTU_D2" amino acids 217 to 286 (70 residues), 69.9 bits, see alignment E=3.1e-23 PF03143: GTP_EFTU_D3" amino acids 290 to 384 (95 residues), 137.2 bits, see alignment E=3.8e-44

Best Hits

Swiss-Prot: 95% identical to EFTU_MARHV: Elongation factor Tu (tuf) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K02358, elongation factor Tu (inferred from 95% identity to maq:Maqu_0717)

Predicted SEED Role

"Translation elongation factor Tu" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLX4 at UniProt or InterPro

Protein Sequence (386 amino acids)

>HP15_366 translation elongation factor Tu (Marinobacter adhaerens HP15)
MNVGTIGHVDHGKTTLTAALTRVCHEVWGTGSASAFDQIDNAPEEKARGITIATSHVEYD
SPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLSRQVGVPYI
VVFLNKADMVDDEELLELVEMEVRDLLSQYDFPGDDTPIITGSALMALEGKDDNEMGTTA
VKRLVEALDDYIPEPERAIDQPFLMPIEDVFSISGRGTVVTGRVERGVIKTGDEVEIVGI
KDTVKTTCTGVEMFRKLLDEGRAGENIGALLRGTKRDDVERGQVLAVPGSITPHTKFECE
VYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGSCELPEGVEMVMPGDNVKMSVTLIAPIA
MEDGLRFAIREGGRTVGAGVVSKIIE