Protein Info for Psest_3836 in Pseudomonas stutzeri RCH2

Annotation: L-lactate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 49 (19 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 156 to 173 (18 residues), see Phobius details amino acids 193 to 219 (27 residues), see Phobius details amino acids 233 to 256 (24 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 322 to 340 (19 residues), see Phobius details amino acids 370 to 387 (18 residues), see Phobius details amino acids 407 to 424 (18 residues), see Phobius details amino acids 448 to 468 (21 residues), see Phobius details amino acids 480 to 499 (20 residues), see Phobius details amino acids 505 to 526 (22 residues), see Phobius details amino acids 538 to 557 (20 residues), see Phobius details PF02652: Lactate_perm" amino acids 7 to 548 (542 residues), 338.2 bits, see alignment E=5e-105

Best Hits

KEGG orthology group: K03303, lactate transporter, LctP family (inferred from 98% identity to psa:PST_0436)

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQM3 at UniProt or InterPro

Protein Sequence (567 amino acids)

>Psest_3836 L-lactate permease (Pseudomonas stutzeri RCH2)
MSQTLLSILAFVPLVLAGVLLIGFRWPAKYAMPLVFVLTALIGLLAWDMTLNRVIASTLQ
GLILTAAILWIIFGAILLLNTLKHSGGISSIRRGFSNVSPDRRVQVLIVAWLFGCFIEGA
SGFGTPAAVAAPLMVALGFPALAAVVMGMMVQSTPVSFGAVGTPILVGVGAGLDKTGISE
QLAAVGSNWEVFFHLIFSRVAIIHALCGILMPLIMVSIMTRYFGRNKSWTEGLAVAPFAV
FTGLAFVIPYAAAGVFLGPEFPSMIGALVGLAIVVPAAKAGFLLPKDTWDFAPAKEWPSE
WMGKIEMKIEDVAGKTPISVPMAWAPYLLLAGLLVASRVFPDFKALLMSLSFGWKDILGE
TGVSGTLEPLYLPGGILCMVVLITFFLHRMKASELGAAISESSKTLLGAGFVLIFTIPMV
RILINSGVNGSDLVSMPVAMAQLVANSVGSVYPFFAPAVGALGAFIAGSNTVSNLMLSQF
QFNTAGLLGLSGALMVALQSVGAAAGNMIAIHNVVAASATVGLLGREGITLRKTMLPTLY
YLILAGAIGLIGFYVLGISDPLVAAAG