Protein Info for Psest_3835 in Pseudomonas stutzeri RCH2

Annotation: Rubredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00301: Rubredoxin
  • amino acids 3 to 49 (47 residues), 81.4 bits, E=3.8e-27

Best Hits

Swiss-Prot: 82% identical to RUBR1_PSEAE: Rubredoxin-1 (rubA1) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 93% identity to psa:PST_0437)

MetaCyc: 66% identical to MTBE monooxygenase rubredoxin component (Methylibium petroleiphilum PM1)
1.14.13.M36 [EC: 1.14.13.M36]

Predicted SEED Role

"Rubredoxin" in subsystem Rubrerythrin

MetaCyc Pathways

• methyl tert-butyl ether degradation (3/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.M36

Sequence Analysis Tools

See L0GSE9 at UniProt or InterPro

Protein Sequence (55 amino acids)

>Psest_3835 Rubredoxin (Pseudomonas stutzeri RCH2)
MKKWQCVVCGYIYDEALGVPDEGIAPGTAWEDVPEDWMCPDCGVGKMDFEMIAIG