Protein Info for Psest_3828 in Pseudomonas stutzeri RCH2

Annotation: zinc-binding alcohol dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02817: zinc-binding alcohol dehydrogenase family protein
  • amino acids 2 to 337 (336 residues), 568.9 bits, E=2.2e-175
• PF08240: ADH_N
  • amino acids 31 to 93 (63 residues), 35.7 bits, E=9.9e-13
• PF00107: ADH_zinc_N
  • amino acids 160 to 264 (105 residues), 45.4 bits, E=1.2e-15
• PF13602: ADH_zinc_N_2
  • amino acids 193 to 334 (142 residues), 65.3 bits, E=1.7e-21

Best Hits

KEGG orthology group: None (inferred from 99% identity to psa:PST_0444)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

See L0GNG8 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Psest_3828 zinc-binding alcohol dehydrogenase family protein (Pseudomonas stutzeri RCH2)
MKAVAYFESLAIDDPRALQDVELPQPVPGPRDLLVEVRAISVNPVDTKVRRNTQPEVGQP
KVLGWDVAGVVVGVGSEVSLFKVGDEVFYAGSIARAGGNSERHLVDERIVGRKPRSLSFA
EAAALPLTAITAWELLFERLQLVEGQGAGQQLLIVGAAGGVGSIMLQLARQLTKVSVIAT
ASRPETQAWARELGAHHVIDHSQPLHAELQRAGFASVSHVASLTQTDQHFDQLVEALTPQ
GRLALIDDPAQPLDVMKLKRKSLSLHWELMFTRSLFETPDMIEQHHLLQRVSQLVDLGVL
RSTLGEHFGTINAANLRRAHALLESGKAKGKIVLEGF