Protein Info for PGA1_262p01610 in Phaeobacter inhibens DSM 17395

Annotation: putative ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 6 to 33 (28 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details amino acids 288 to 310 (23 residues), see Phobius details amino acids 330 to 359 (30 residues), see Phobius details amino acids 382 to 401 (20 residues), see Phobius details PF12704: MacB_PCD" amino acids 19 to 205 (187 residues), 55.1 bits, see alignment E=1.3e-18 PF02687: FtsX" amino acids 289 to 407 (119 residues), 62.5 bits, see alignment E=4e-21

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 80% identity to rde:RD1_1737)

Predicted SEED Role

"ABC-type antimicrobial peptide transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F2G4 at UniProt or InterPro

Protein Sequence (416 amino acids)

>PGA1_262p01610 putative ABC transporter, permease protein (Phaeobacter inhibens DSM 17395)
MILRLAIASLFARALTVGMTVLAIALSVALFLGVEKIRTGAKASFADTISGTDLIVGARS
GSVQLLLYSVFRIGNATNNVTWESYQDIAKRPDVDWIVPISLGDSHHQFRVMGTTTAFFD
HYKYRQGRPLKMADGAPMEDLFDTVIGADVAGTLGYHVGDPIIVAHGLASFAKHKDQPFR
VSGILEKTGTPVDRTVIVSMKAIEAIHVDWQSGAQIPGQSTPVDVIREMELTPKAITAAL
IGVESPLQTFALQRAINEYREEPLLAILPGVALQELWSIVGIAETALLTVSAMVVVTALI
GMMATIFSSLNERRREMAIFRAMGARPRTILSLLVLEAMMMATVGALLGLVLLYIGLFVA
QPILDSTFGLWIPIDTPTLREFWVLLAVICAGVIVSLIPAMRAYRMSVADGMVVKT