Protein Info for HP15_3697 in Marinobacter adhaerens HP15

Annotation: phytanoyl-CoA dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02408: ectoine hydroxylase
  • amino acids 22 to 294 (273 residues), 376 bits, E=5.5e-117
• PF05721: PhyH
  • amino acids 47 to 262 (216 residues), 127.9 bits, E=3.6e-41

Best Hits

Swiss-Prot: 51% identical to ECTD_BORBR: Ectoine dioxygenase (ectD) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K10674, ectoine hydroxylase [EC: 1.14.11.-] (inferred from 86% identity to maq:Maqu_3892)

Predicted SEED Role

"Ectoine hydroxylase (EC 1.17.-.-)" in subsystem Ectoine biosynthesis and regulation (EC 1.17.-.-)

KEGG Metabolic Maps

• Benzoxazinone biosynthesis
• Diterpenoid biosynthesis
• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.- or 1.17.-.-

Sequence Analysis Tools

See E4PHG0 at UniProt or InterPro

Protein Sequence (311 amino acids)

>HP15_3697 phytanoyl-CoA dioxygenase (Marinobacter adhaerens HP15)
METRTDDFYPTRLERPTKSFERQDPVVHSSGSDRSDGPLSETELAQYERDGFLVFDSFLD
QATVRQFREDLRGYEDDESILRSEGTITEPGKQGIRSIFGIHELSDRFDRLTRDPRILAM
VRQLLGSEAYIHQSRINFKPGFHGKGFDWHSDFETWHAEDGMPRMRAVSFSIALTDNTPF
NGPLMLIPGSHKTFVPCVGRTPEDNYQSSLKKQELGVPNNRDLAAMADDYGIKAPTGPAG
SLIIFECNTLHASNANMSPWPRSNLFFVYNSVENQLQAPFCGNKPRPDFLGNRTSTEALM
PVTSEERRKTG