Protein Info for HP15_3697 in Marinobacter adhaerens HP15
Annotation: phytanoyl-CoA dioxygenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 51% identical to ECTD_BORBR: Ectoine dioxygenase (ectD) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
KEGG orthology group: K10674, ectoine hydroxylase [EC: 1.14.11.-] (inferred from 86% identity to maq:Maqu_3892)Predicted SEED Role
"Ectoine hydroxylase (EC 1.17.-.-)" in subsystem Ectoine biosynthesis and regulation (EC 1.17.-.-)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.14.11.-
Use Curated BLAST to search for 1.14.11.- or 1.17.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E4PHG0 at UniProt or InterPro
Protein Sequence (311 amino acids)
>HP15_3697 phytanoyl-CoA dioxygenase (Marinobacter adhaerens HP15) METRTDDFYPTRLERPTKSFERQDPVVHSSGSDRSDGPLSETELAQYERDGFLVFDSFLD QATVRQFREDLRGYEDDESILRSEGTITEPGKQGIRSIFGIHELSDRFDRLTRDPRILAM VRQLLGSEAYIHQSRINFKPGFHGKGFDWHSDFETWHAEDGMPRMRAVSFSIALTDNTPF NGPLMLIPGSHKTFVPCVGRTPEDNYQSSLKKQELGVPNNRDLAAMADDYGIKAPTGPAG SLIIFECNTLHASNANMSPWPRSNLFFVYNSVENQLQAPFCGNKPRPDFLGNRTSTEALM PVTSEERRKTG