Protein Info for Psest_3813 in Pseudomonas stutzeri RCH2

Annotation: ribonuclease PH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 TIGR01966: ribonuclease PH" amino acids 3 to 238 (236 residues), 377.7 bits, see alignment E=8.9e-118 PF01138: RNase_PH" amino acids 11 to 141 (131 residues), 110.3 bits, see alignment E=9.4e-36 PF03725: RNase_PH_C" amino acids 160 to 226 (67 residues), 55.9 bits, see alignment E=3.5e-19

Best Hits

Swiss-Prot: 96% identical to RNPH_PSEU5: Ribonuclease PH (rph) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00989, ribonuclease PH [EC: 2.7.7.56] (inferred from 96% identity to psa:PST_0463)

Predicted SEED Role

"Ribonuclease PH (EC 2.7.7.56)" in subsystem Heat shock dnaK gene cluster extended or tRNA processing (EC 2.7.7.56)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNF6 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Psest_3813 ribonuclease PH (Pseudomonas stutzeri RCH2)
MKRPSGRAADQLRSIRITRNYTKHAEGSVLVEFGDTKVICTVSIETGVPRFLKGQGQGWL
TAEYGMLPRATGERNQREASRGKQGGRTLEIQRLIGRSLRAALDMSKLGENTLFVDCDVI
QADGGTRTASITGAMVALIDALKALKKRGGLKSGDPIKQMIAAVSVGIYQGEPVLDLDYL
EDSAAETDLNVVMTDAGGFIEVQGTAEGAPFHPEELNAMLALAHDGVRQLFELQRAALAD