Protein Info for PGA1_262p01440 in Phaeobacter inhibens DSM 17395

Annotation: BCCT transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 198 to 221 (24 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 271 to 299 (29 residues), see Phobius details amino acids 324 to 346 (23 residues), see Phobius details amino acids 358 to 382 (25 residues), see Phobius details amino acids 414 to 433 (20 residues), see Phobius details amino acids 454 to 475 (22 residues), see Phobius details amino acids 483 to 504 (22 residues), see Phobius details PF02028: BCCT" amino acids 18 to 506 (489 residues), 492.2 bits, see alignment E=7.2e-152

Best Hits

Swiss-Prot: 60% identical to BCCT4_VIBPA: Glycine betaine transporter 2 (VPA0356) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: None (inferred from 89% identity to sit:TM1040_3383)

Predicted SEED Role

"Glycine betaine transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F4P3 at UniProt or InterPro

Protein Sequence (514 amino acids)

>PGA1_262p01440 BCCT transporter (Phaeobacter inhibens DSM 17395)
MSETSMETTPQESRINKPLFLLSGGFIALFCVAALVNLDGLSALVDWGFNIAATYFGLYW
QILLLATFLIGLVLCILPGGRAIMGGLATPEFTTFQWGSMIMCTLLAGGGVFWAAGEPIA
HFLYSPPLYGAEGGSEAAVTPAIAQSFMHWGFLAWAILGSLSTVMLMHYHYEKGLPLAPR
TLLYPVFGDKAINGPIGVIADASSIIAVVAGTVGPIGFLGLQVSYGLSDLFGIPDVFATQ
FVVIGALVALYTISAMTGLSRGIQLLSKINVILAAVLLIYVLLAGPTGFIFGSFFSGFAT
YLGNFFQMALYRGDAAVFGAPGWLGWWTVFFWGWFMGYGPLMAMFIARVSRGRSIRSIII
MLSIIAPIVTNFWFTIIGGTGIAMELAEPGTVSAAFEGFNLPAALLAITNNLPMGFLVSI
LFLILTTIFVATTGDSMSYVISATMTKGDTPSTAVRVFWGIAMGVMAVILISVGSGGVSK
LQSFIVVTAVPVSLILLPSLWDALRITLAKGKES