Protein Info for PGA1_c03840 in Phaeobacter inhibens DSM 17395

Annotation: methylmalonyl-CoA mutase large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 655 TIGR00641: methylmalonyl-CoA mutase N-terminal domain" amino acids 2 to 490 (489 residues), 448.5 bits, see alignment E=2.5e-138 PF01642: MM_CoA_mutase" amino acids 2 to 485 (484 residues), 457.5 bits, see alignment E=5.2e-141 TIGR00640: methylmalonyl-CoA mutase C-terminal domain" amino acids 520 to 642 (123 residues), 119 bits, see alignment E=1.4e-38 PF02310: B12-binding" amino acids 523 to 626 (104 residues), 57.8 bits, see alignment E=1e-19

Best Hits

Swiss-Prot: 66% identical to MEAA_METEA: Protein MeaA (meaA) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)

KEGG orthology group: K14447, ethylmalonyl-CoA mutase (inferred from 87% identity to sil:SPO0368)

Predicted SEED Role

"Ethylmalonyl-CoA mutase, methylsuccinyl-CoA-forming"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EIZ4 at UniProt or InterPro

Protein Sequence (655 amino acids)

>PGA1_c03840 methylmalonyl-CoA mutase large subunit (Phaeobacter inhibens DSM 17395)
MPQMQKDRPWLIRTYAGHSTASASNALYRANLAKGQTGLSVAFDLPTQTGYDSDHVLARG
EVGKVGVPVCHLGDMRSLFDQIPLEQMNTSMTINATAPWLLSLYIAVAEEQGADVSKLQG
TVQNDLIKEYLSRGTYVCPPKPSLKMIADVAEYCYTNAPKWNPMNVCSYHLQEAGATPEQ
ELAFALATAQAVLDELKPRITPEDFPAMVGRISFFVNAGIRFVTEMCKMRAFVDLWDEIC
RDRYGVEDPKFRRFRYGVQVNSLGLTEQQPENNVYRILIEMLAVTLSKKARARAVQLPAW
NEALGLPRPWDQQWSMRMQQILAYETDLLEYGDLFDGNPAVDAKVEDLKTGARAELANLE
SMGGAVASIEYMKGRLVDSNAERLNRIEKNETIVVGVNKWTEGEPSPLQTEDGGIMVVDP
AVEQEQINRLDDWRSGRDDDAVQSALAALRAAAQNGDNIMPPSIAAAKAGVTTGEWAEEM
RKVYGTYRGPTGVSGSASNKTEGLDELRDKVNAVSDQLGRRLKFLVGKPGLDGHSNGAEQ
IAFRARDCGMDITYDGIRMTPEELVASAIADDAHVVGMSILSGSHLPLIEELMGRMTEAG
LSHVPVIVGGIIPDDDADRLKKMGVARVYTPKDFELNAIMGDIVELAKQPETATH