Protein Info for Psest_3794 in Pseudomonas stutzeri RCH2

Annotation: Transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF13404: HTH_AsnC-type" amino acids 11 to 52 (42 residues), 67.3 bits, see alignment E=1.7e-22 PF13412: HTH_24" amino acids 11 to 57 (47 residues), 67.6 bits, see alignment E=1.1e-22 PF01047: MarR" amino acids 17 to 58 (42 residues), 26.1 bits, see alignment E=1.3e-09 PF01037: AsnC_trans_reg" amino acids 75 to 155 (81 residues), 82.6 bits, see alignment E=3e-27

Best Hits

Swiss-Prot: 60% identical to LRP_SHIFL: Leucine-responsive regulatory protein (lrp) from Shigella flexneri

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 100% identity to psa:PST_0482)

Predicted SEED Role

"Leucine-responsive regulatory protein, regulator for leucine (or lrp) regulon and high-affinity branched-chain amino acid transport system" in subsystem Branched-Chain Amino Acid Biosynthesis or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSI3 at UniProt or InterPro

Protein Sequence (162 amino acids)

>Psest_3794 Transcriptional regulators (Pseudomonas stutzeri RCH2)
MRTRHQTRRELDKIDRHILRILQAEGRLPFTELGERVGLSTTPCTERVRRLEREGIIMGY
SARLNPQHLKAGLLVFVEISLAYKSGDIFEEFRRAVLKLPHVLECHLVSGDFDYLVKARI
SEMASYRKLLGDILLKLPHVRESKSYIVMEEIKESLDLPVPD