Protein Info for PGA1_262p01250 in Phaeobacter inhibens DSM 17395

Annotation: transcriptional regulator, crp family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF00027: cNMP_binding" amino acids 41 to 122 (82 residues), 61.8 bits, see alignment E=7.8e-21 PF13545: HTH_Crp_2" amino acids 157 to 229 (73 residues), 65.7 bits, see alignment E=4.5e-22 PF00325: Crp" amino acids 183 to 212 (30 residues), 23 bits, see alignment 7.9e-09

Best Hits

KEGG orthology group: None (inferred from 66% identity to rsk:RSKD131_1656)

Predicted SEED Role

"Nitric oxide -responding transcriptional regulator NnrR (Crp/Fnr family)" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DWI7 at UniProt or InterPro

Protein Sequence (234 amino acids)

>PGA1_262p01250 transcriptional regulator, crp family (Phaeobacter inhibens DSM 17395)
MFGDAVRHLHESLLRPLPPFSQLADAQIRTILDHASSRGVGPGQTVFAEGDPAETFYLLL
DGTIRVVRISSDGEQVTSLHIPPGQLFGIARALGRDSYPATAVAASEALMLCWPTSLWDS
FIVDYPGFATETYKTVGARIGEMNARIMEMSTQHVEQRVARALLRLINQSGIKVAQGIEI
GFPITRQDVSELTGTTLHTVSRLLSAWEKDGMVSSKRKKITICDPHRLMLLSDP