Protein Info for Psest_3786 in Pseudomonas stutzeri RCH2

Annotation: Glycosidases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 PF00128: Alpha-amylase" amino acids 13 to 263 (251 residues), 237.3 bits, see alignment E=8.2e-74 amino acids 344 to 447 (104 residues), 33.8 bits, see alignment E=4.4e-12 PF16657: Malt_amylase_C" amino acids 460 to 530 (71 residues), 32.2 bits, see alignment E=1.7e-11 PF25839: Apionate_lact_C" amino acids 467 to 531 (65 residues), 34.1 bits, see alignment E=6.3e-12 PF22157: SupH-like_C" amino acids 476 to 532 (57 residues), 37.9 bits, see alignment 4.4e-13

Best Hits

KEGG orthology group: None (inferred from 92% identity to psa:PST_0489)

Predicted SEED Role

"Trehalose synthase (EC 5.4.99.16)" in subsystem Trehalose Biosynthesis (EC 5.4.99.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.99.16

Use Curated BLAST to search for 5.4.99.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQG0 at UniProt or InterPro

Protein Sequence (539 amino acids)

>Psest_3786 Glycosidases (Pseudomonas stutzeri RCH2)
MRPLWYRNAAIYQIDPTLFRDSNGDGCGDLRGITERLDYIRGLGCTAVWLMPFYQSPFED
AGYDISDHLQVDERFGDLADIVALLEKAEELGLHVIIELVVQHTSIQHKWFQEARRDRNS
PYRDYYIWADEPDDFMEPIFPTVEDSIWTWDEEAGQYYRHLFYKHEPDLDLTNPRVIHEI
ERIMSFWLRLGVSGFRIDAAVHMVRQAGGGELEKGYWLLEHMRDFVTMRRPETVLLGEID
TDPDKYVEYFGDEADRVTLLLDFWTNNHLFLSLARQQAEPLVRALNSQPLPPSHSQYALW
IRNHDELSLDRLEEDERNEVMDTFAPDENMRAYNRGIRRRLAPMLDGDERRIAATHALLF
SLPGTPIIRYGEEIGMGDDLDRPERLAVRTPMQWSNEPNAGFSCTKGELAAPVIDEGPFT
YEKINVFAQTLRSDSLMARTGNMIRTRIGLREIGIGKRTTVEVNDPAVFAIRHDNGSTVL
MLVNLADQETTVEITDDDLQDMVDVLADCDYDQPEGTPLKIRLGPYGYRWLRRKQQLFG