Protein Info for Psest_3777 in Pseudomonas stutzeri RCH2

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 118 to 272 (155 residues), 81.8 bits, see alignment E=2.4e-27 PF00990: GGDEF" amino acids 123 to 272 (150 residues), 110 bits, see alignment E=1e-35 PF00563: EAL" amino acids 297 to 531 (235 residues), 251.7 bits, see alignment E=6.6e-79

Best Hits

KEGG orthology group: None (inferred from 85% identity to psa:PST_0498)

Predicted SEED Role

"GGDEF domain/EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GR35 at UniProt or InterPro

Protein Sequence (552 amino acids)

>Psest_3777 diguanylate cyclase (GGDEF) domain (Pseudomonas stutzeri RCH2)
MSAPVQTMPLLLLADRPEWATRLRDCLQASHCTERLVIAASCESAGELLASPCLLLATPQ
CRPPVGRYPWPLILLLDEEPADSPEGAVDWLVADQLSPEVLRRCLRYVRERCNLQGTLQK
LAEQDPHTGIVNRQGFQTLLFDALAEHQEQGLVLGYLDLDNFRHVNDALGHEAGDRLILQ
VVARLKAQLEVGDMLARLGGDEFALLLDTRGDPQRAEAVADRIVEALAEPYWVEGESLML
GCSIGLARASAGIKADPLLWHAQIAMRQAKASQGCTWCFYDEQVSRSARSLADQEGELRR
ALRRGELELHYQPRLCLESGRIVGLEALVRWLHPERGLLAPDAFIPMAEESGLIVPLGYW
VIARALRDLQSLQDGGADALHMAINLSFRQFQDSQLLPTLNRLIDERGIDPHWLEFELTE
TAVMRRSDQVQSAMNALGELGVRFSLDDFGTGFSSFVHLSSLPITLLKIDKSFVAGMILR
PEKLQLVQAMVGLAHNLDLEVVAEGVETAEQLELLRQFGAQQVQGYLVSQPLPLAELVSF
MSAERLSAGVAH