Protein Info for Psest_3768 in Pseudomonas stutzeri RCH2

Annotation: haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED/haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF00702: Hydrolase" amino acids 3 to 194 (192 residues), 83.3 bits, see alignment E=4.6e-27 PF13419: HAD_2" amino acids 7 to 199 (193 residues), 65.4 bits, see alignment E=1.1e-21 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 92 to 199 (108 residues), 40.7 bits, see alignment E=2.8e-14 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 92 to 194 (103 residues), 50.9 bits, see alignment E=2.3e-17 PF13242: Hydrolase_like" amino acids 154 to 199 (46 residues), 37.4 bits, see alignment 2.9e-13

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 92% identity to psa:PST_0507)

Predicted SEED Role

"Putative FMN hydrolase (EC 3.1.3.-); 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase" (EC 3.1.3.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNB4 at UniProt or InterPro

Protein Sequence (233 amino acids)

>Psest_3768 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED/haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E (Pseudomonas stutzeri RCH2)
MSIRLITFDLDDTFWETTPAIQSAETALRDWLAVHAPRLGEFPVEALGAIRRMLIERDPA
LRHRISELRRRILQHALHDAGYPADEADGLAEQAFQVFLDARHEVQIFPDVQPTLEFLAN
HYTLGVITNGNADVRRLGLADYFQFTLCAEELGVGKPDPHPFQQALRLGDARPEQAVHIG
DHALDDIAGAQQAGLRAIWFNPKRAVWPHDYHPDAEIQSLAGLPKLLHGWRGD