Protein Info for PGA1_262p01020 in Phaeobacter inhibens DSM 17395

Annotation: dipeptide transport system permease protein DppC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 103 to 129 (27 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 229 to 254 (26 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details PF12911: OppC_N" amino acids 25 to 72 (48 residues), 44.9 bits, see alignment 8.9e-16 PF00528: BPD_transp_1" amino acids 119 to 312 (194 residues), 105.2 bits, see alignment E=3.6e-34

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 92% identity to sil:SPO3776)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E6B4 at UniProt or InterPro

Protein Sequence (315 amino acids)

>PGA1_262p01020 dipeptide transport system permease protein DppC (Phaeobacter inhibens DSM 17395)
MSSLSTNQSTPSRFSRLWNSNMGYSFRRNPVAMVSFAVFLVITIASILAPVLAPFDPYDP
AQIDIMNSEYPPVWIDGSDSQFVFGTDDQGRDLWSTILYGTRLSLLIGLCAVALQAFLGI
SIGLVAGYVGGRLDSLLMRFADIQLSFSTLMVAIIFLAVTQAMFGSETFNQYAIYFLIAV
IGVAEWPQYARTVRATVLAEKKKEYIDSARVLGFGPMRIMVRHILPNSLSPIFVISTVQV
ANAIISEASLSFLGLGMPPSQPSLGSLISSGFDYIFSGSWWITAIPGVVLVVLVLVINLL
GDWMRDVLNPKLYKG