Protein Info for Psest_3766 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 PF04340: DUF484" amino acids 13 to 222 (210 residues), 258 bits, see alignment E=4.1e-81

Best Hits

KEGG orthology group: K09921, hypothetical protein (inferred from 95% identity to psa:PST_0509)

Predicted SEED Role

"Protein of unknown function DUF484"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQE2 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Psest_3766 Uncharacterized protein conserved in bacteria (Pseudomonas stutzeri RCH2)
MTDQTQGSTPLPDAEAVAAYLRAHPEFFVDHDELIPELRIPHQPGTAVSLVERQVKLLRE
RNIEMRHRLSQLMDVARDNDRLFDKTRRLVLDLLDASSLEEVVSAVEDSLRHEFQVPYVS
LILFSEATLPVGRCVSTGEAQQSIGGLLDGGKTICGVLRPHELNFLFGEDGGSVGSAAVV
SLNNQLGVLAIGSPDPQHYKSSLGTLFLGYIAEVLTRVLPRFGTPLRSVR