Protein Info for Psest_3764 in Pseudomonas stutzeri RCH2

Annotation: diaminopimelate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01048: diaminopimelate decarboxylase
  • amino acids 6 to 410 (405 residues), 538.6 bits, E=3.8e-166
• PF00278: Orn_DAP_Arg_deC
  • amino acids 30 to 368 (339 residues), 96.9 bits, E=1.1e-31
• PF02784: Orn_Arg_deC_N
  • amino acids 35 to 280 (246 residues), 264 bits, E=1.9e-82
• PF01168: Ala_racemase_N
  • amino acids 35 to 234 (200 residues), 40.7 bits, E=3.3e-14

Best Hits

Swiss-Prot: 87% identical to DCDA_PSEAE: Diaminopimelate decarboxylase (lysA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 98% identity to psa:PST_0511)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

See L0GSF3 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Psest_3764 diaminopimelate decarboxylase (Pseudomonas stutzeri RCH2)
MEAFSYRDGQLFAEGVALPALAQRFGTPTYVYSRAHIEAQYRAYADALDGMPHLVCFAVK
ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGQPDRIVFSGVGKTRDDMRRALEVGVH
CFNVESTDELERLQQVAAELGKKAPVSLRVNPDVDAGTHPYISTGLKENKFGIDIDNAEA
VYARAAELPNLEVVGVDCHIGSQLTSLPPFLDALDRLLALTDRLAARGIQIRHLDLGGGL
GVRYRDEQPPLAGDYIQAVRQRIEGRGLALVFEPGRSIVANAGVLLTRVEYLKHTAHKDF
AIVDAAMNDLIRPALYQAWMNVIAVQPHEGDTRRYDIVGPICETGDFLAKDRELALVEGD
LLAVCSAGAYGFVMSSNYNTRGRAAEVLVDGDQAFEVRRRESVQELYAGESLLPT