Protein Info for PGA1_262p00880 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter, integral inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 29 to 53 (25 residues), see Phobius details amino acids 95 to 104 (10 residues), see Phobius details amino acids 124 to 148 (25 residues), see Phobius details amino acids 166 to 192 (27 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details amino acids 317 to 336 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 143 to 346 (204 residues), 89.9 bits, see alignment E=8.6e-30

Best Hits

KEGG orthology group: None (inferred from 54% identity to pde:Pden_1609)

Predicted SEED Role

"oligopeptide ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F4J4 at UniProt or InterPro

Protein Sequence (347 amino acids)

>PGA1_262p00880 ABC transporter, integral inner membrane component (Phaeobacter inhibens DSM 17395)
MDNASPSLLDHPVSTEITGAGSPAVGRFAGLIGGFVLRLLIFCFVIVLCAVLSRMMPGDT
LQVMLSTDLARGLGTGEAQQLQETMGLGGGIASQVWAYLSRLLAGDLGYSIPHAAPVLQL
LLTALPWTGLLILGAMPVFLIGGALAGIEAGQLPGGSVDRWVTPVVTMLASLPPFTGAVL
LLLVFGILWPVLPTGGAEPLFPAMDQLGRAVGVLRHAILPMLALALHELARFYFLARAET
LNLAQRDFIVNAGARGISPWRLRWAYIGRSLIPACLSRLSDTLTGLVSAVFFVEIVFSYP
GTGYLIYSAILDRDYDLLQGAVVFMAGVVLLMNWLVDGLSGHLARRG