Protein Info for Psest_3750 in Pseudomonas stutzeri RCH2

Annotation: Predicted signal transduction protein with a C-terminal ATPase domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 81 to 107 (27 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details PF06580: His_kinase" amino acids 154 to 232 (79 residues), 80.8 bits, see alignment E=3.5e-27

Best Hits

KEGG orthology group: K08082, two-component system, LytT family, sensor histidine kinase AlgZ [EC: 2.7.13.3] (inferred from 97% identity to psa:PST_0522)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQC8 at UniProt or InterPro

Protein Sequence (352 amino acids)

>Psest_3750 Predicted signal transduction protein with a C-terminal ATPase domain (Pseudomonas stutzeri RCH2)
MKSTALTDDFFVPELCQPEALLGLVLLAELLVFVLVLAEPMQPSFNWMRLALTSLFVQWI
VLLSAGTMCLLRPLLARLRAAFAGLACCALVVGLTLACTAVADIYQLGGPLSRDGEVNLY
LRHALISLIMSGLLLRYFYLQSQWRRQEQAELRARIESLQARIRPHFLFNSLNSIAALVA
SDPVKAEQAVLDLSDLFRASLARPGTLVAWSEELELSRRYLSIEQYRLGDRLQMDWQVDG
VPDDLPIPQLTLQPLLENALVYGIQPRIEGGVVSVTADYVDGTFQLVVSNPFDEVAQTQA
SRGTRQGLQNIDARLAALFGPLASLSVERREGRHYTCLRYPCARQTQEARSI