Protein Info for PGA1_262p00770 in Phaeobacter inhibens DSM 17395

Annotation: putative lytic murein transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02283: lytic murein transglycosylase" amino acids 31 to 339 (309 residues), 330.7 bits, see alignment E=4e-103 PF13406: SLT_2" amino acids 32 to 336 (305 residues), 307.4 bits, see alignment E=1e-95 PF01471: PG_binding_1" amino acids 358 to 405 (48 residues), 25.3 bits, see alignment 1.4e-09

Best Hits

KEGG orthology group: None (inferred from 61% identity to bov:BOV_0031)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E699 at UniProt or InterPro

Protein Sequence (414 amino acids)

>PGA1_262p00770 putative lytic murein transglycosylase (Phaeobacter inhibens DSM 17395)
MLFRLLSLLMILLALPYGPARAVDRAKVERQFQQWLVQDIWPEARAVGVLRPTFDAAFSK
VSLNWDLPDLVPPGSKATLPRRQRQAEFGAPGRYFNRGSVDGATSMGRRMAKRHASALQQ
TERRTGVPGRIILAIWGRESGYGQVKIPHNVFEVLGTKGFMSRRADYFRQELIAALQIAE
AGHAPEQAMRSSWAGALGQPQFMPSSFLKFAEDGDGDGRADIWRSEADTIASIGGYLARH
GWDKTRDWGFEVSVPASVSCALEGPDQGQSIREWEALGIHRGSGRAFPAHERDGVAYLMM
PAGRNGPAFLVTPNFYVLKEYNKSDLYALFVGHVGDRIQFGVQDFRGAWGRVDSMLRSDV
AAMQRGLERRDYDVGGADGLAGFKTRRSIGRWQEATGQQATCFPSAAMKADLSR