Protein Info for HP15_3613 in Marinobacter adhaerens HP15

Annotation: conserved hypothetical protein, membrane

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 39 to 70 (32 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 106 to 122 (17 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details PF10688: Imp-YgjV" amino acids 14 to 171 (158 residues), 138.8 bits, see alignment E=6.6e-45

Best Hits

KEGG orthology group: None (inferred from 84% identity to maq:Maqu_3833)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGR8 at UniProt or InterPro

Protein Sequence (182 amino acids)

>HP15_3613 conserved hypothetical protein, membrane (Marinobacter adhaerens HP15)
MIDLIADMTLAEVLGQVCGLVALGFCIAGFANKNDDRLMVLLISANVAFALMFAFFESWT
ASALTVLVIVRITLARKYQGNWPIMLGILAVNLVVAWATWKSITDVFPLAAAVFGTVGMF
MLRGIPLRIVLGFAALAWMLNNIVIGSVGGTLAEGMVLVTNIITIIRLYRLQKKYPDFTP
GS