Protein Info for PGA1_262p00680 in Phaeobacter inhibens DSM 17395

Annotation: Uncharacterized membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 129 to 163 (35 residues), see Phobius details PF02308: MgtC" amino acids 39 to 167 (129 residues), 102.7 bits, see alignment E=9.2e-34

Best Hits

Predicted SEED Role

"MgtC family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F4I1 at UniProt or InterPro

Protein Sequence (184 amino acids)

>PGA1_262p00680 Uncharacterized membrane protein (Phaeobacter inhibens DSM 17395)
MAVSRHSLCISAAPLERSTMSASQTAAMIAYDSFLLRCCLAVALGLLIGLDREIKKKPLG
ARAYMLICLGCCALTMLTLNLAATAQEGTAAVDPSRTIQGIVGGIGFLGAGAIMSTTETG
KLRGVGSGAAIWVVGVVGIAVGFGFIAEAASVALLAFLILTIVDWAQQHRPDLDNGRDTS
DGED