Protein Info for HP15_3604 in Marinobacter adhaerens HP15

Annotation: outer membrane protein OmpW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13505: OMP_b-brl" amino acids 12 to 242 (231 residues), 41.7 bits, see alignment E=2.2e-14 PF03922: OmpW" amino acids 27 to 242 (216 residues), 204.9 bits, see alignment E=1.8e-64

Best Hits

Swiss-Prot: 47% identical to OMPW_VIBCH: Outer membrane protein W (ompW) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07275, outer membrane protein (inferred from 56% identity to maq:Maqu_3824)

Predicted SEED Role

"Outer membrane protein W precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGQ9 at UniProt or InterPro

Protein Sequence (242 amino acids)

>HP15_3604 outer membrane protein OmpW (Marinobacter adhaerens HP15)
MDMSRTFKLGVLAAAVMAAAPAVQAYEAGDFIGRVGVATVDPDSSSGNLNSNALGEIDGA
KVSVDSNSQLGLTATYMLTDQIGVGVLAATPFKHDIKGDGAALGGTGKLAETKHLPPTIT
LQYFPMPSGSKFQPYVGAGVNYTNFFEEKTTQTLTNTYDAVAGNPGIDGTDIKLDDSFGL
AAEIGLDYMITENVGINAAVWWIDIDTEATINAYAGNAVADTSTIDVDIDPWVYMVGVSY
KF