Protein Info for Psest_3727 in Pseudomonas stutzeri RCH2

Annotation: 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00523, CDP-4-dehydro-6-deoxyglucose reductase [EC: 1.17.1.1] (inferred from 94% identity to psa:PST_0545)

Predicted SEED Role

"2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases / CDP-6-deoxy-delta-3,4-glucoseen reductase-like" in subsystem Central meta-cleavage pathway of aromatic compound degradation

MetaCyc Pathways

CDP-4-dehydro-3,6-dideoxy-D-glucose biosynthesis (1/3 steps found)
superpathway of CDP-glucose-derived O-antigen building blocks biosynthesis (1/8 steps found)

KEGG Metabolic Maps

Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSC0 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Psest_3727 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases (Pseudomonas stutzeri RCH2)
MKVTLQPSGAVLDVRPGERFLDAARRLGYECPQSCRNGNCHICASLLVEGRVRQAGEVRD
HGELLACLAEPLEDCVLLWDGVLAPGELPVRELSCQLSGYEEVGGDVVRLRLRLPAGRQP
RYHAGQYLLLQREDGEWSAFSLASAPGSGRELELHVLAREESAIELLAFLQRQGFARVQL
PFGDTHLAELPDGPLVLVAAGTGMAQMHSLIEYCRAAGFVHPVHLYWGVRRPEDFYQLPH
WDEWQGMGNLHLHRVVSDVCGWEGRCGMLHEAIREDFSDLKALHVYASGSPSMVYGTLDA
LVEAGMDPHQMRADVFAYAPRED