Protein Info for Psest_3715 in Pseudomonas stutzeri RCH2

Annotation: type IV pilus secretin (or competence protein) PilQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 693 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF11741: AMIN" amino acids 160 to 262 (103 residues), 64.4 bits, see alignment E=1.7e-21 TIGR02515: type IV pilus secretin PilQ" amino acids 276 to 685 (410 residues), 529.9 bits, see alignment E=2.6e-163 PF07660: STN" amino acids 302 to 349 (48 residues), 37.2 bits, see alignment 4.2e-13 PF03958: Secretin_N" amino acids 375 to 441 (67 residues), 45.7 bits, see alignment E=1.2e-15 PF00263: Secretin" amino acids 528 to 684 (157 residues), 174.8 bits, see alignment E=2.4e-55

Best Hits

Swiss-Prot: 72% identical to PILQ_PSEAE: Fimbrial assembly protein PilQ (pilQ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02666, type IV pilus assembly protein PilQ (inferred from 84% identity to psa:PST_0557)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQX6 at UniProt or InterPro

Protein Sequence (693 amino acids)

>Psest_3715 type IV pilus secretin (or competence protein) PilQ (Pseudomonas stutzeri RCH2)
MNTTLSRLGVSLLAAFISPALLAAKLNALDVAALPGDRVELKLAFDEPVASPRGYTLDQP
ARIALDLPGVSNNLGAKNRELGVGNARSVTVVEAQGRTRLIVNLTSLVPYSTRVDGNNLF
VVLGESAGAGGGTAVSPATAAPVAVSAPVKVAPAGKAIENIDFRRGDDGAGNVIISLSDP
SISPTIEEQGGKIRVIFDKTQLPESLRVRLDVQDFATPVRFVDSTAQSGKASIAIEPTGR
YDYLAYQTDNKLTISIKPLTEDEADKRKADRFAYSGEKLSLNFQDIDVRSVLQLIADFTD
LNLVASDTVSGNITLRLQNVPWDQALDLVLKTKGLDKRQVGNVLLVAPADEIAARERQEL
ESQRQIAELAPLRREVVQVNYAKAADIARLFQSVTNTQGQTDERGSMAVDDRTNNIIAYQ
TQERLDELRRIVAQLDIPVRQVMIEARIVEANVDYDKALGVRWGGTQLFANGRGAVYGND
DLGDEGGNSGDESSGNFPFVDMGVTNRTAGIGIGYITDNLILDLELSAMEKSGNGEVVSQ
PKVMTADKETAKILKGSEIPYQEASSSGATSTTFVEAALSLEVTPQITPDNRIIMEVKVT
KDEPDFANDVNGTPTIRKNEVNAKILVNDGETVVIGGVFSNTQSRSVDKVPFLGDLPYLG
RLFRRDIVADSKSELLIFLTPKILNHQAVAVSR