Protein Info for Psest_3712 in Pseudomonas stutzeri RCH2

Annotation: Type II secretory pathway, component ExeA (predicted ATPase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 transmembrane" amino acids 263 to 281 (19 residues), see Phobius details PF13401: AAA_22" amino acids 48 to 171 (124 residues), 55.4 bits, see alignment E=8.3e-19 PF05036: SPOR" amino acids 428 to 500 (73 residues), 48.6 bits, see alignment E=8.7e-17

Best Hits

KEGG orthology group: K03112, DamX protein (inferred from 82% identity to psa:PST_0560)

Predicted SEED Role

"General secretion pathway protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSA6 at UniProt or InterPro

Protein Sequence (513 amino acids)

>Psest_3712 Type II secretory pathway, component ExeA (predicted ATPase) (Pseudomonas stutzeri RCH2)
MTSLSADDAFLNHYGFSHDPFAARVPGFKFFPAQRKPVLGQLHHLARYSQLLLLVTGPEG
SGKTLLRQALVASSNKQSVQSVVITPQGTMDASALLSQIAQALSSPAADFDGIMTQVTQL
ALTGQEVYLLVDDAECLTGAAVETLLRLAAGSPEARPHVFLFGEPALAGRLEALSEGEER
YHAIALQPYEEDETREYLALRLEGAGSGIECLNEEQIVRVHEQSGGWPGAINQMARDELL
AAMQSRRGSRKTGGIAFPLPRRHLLAAVAVIVVVAVGYLALRGGDTQAPLPPAVTSLPLD
SSSADGAAGQDRQTAIEFDGEERPLSLPLGGDAQPVIREPLAAAAGGEDDREASVRGATA
PMMPAPAPAPAPAPAPVERAQPVPAPPVAAPTPALAAPVRPNVAERPPAPAAAPASSGHG
AWYASQPGSNYLVQILGTRVEKNAQALVQQHGGSYRYFAKQHEGKPLYVVTYGNFANRAA
AVAAVKSLPASLQAGKPWVRSLASVQQEMTQSR