Protein Info for HP15_3587 in Marinobacter adhaerens HP15

Annotation: membrane-associated metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 118 to 141 (24 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details PF08019: EptA_B_N" amino acids 58 to 203 (146 residues), 143.6 bits, see alignment E=4.5e-46 PF00884: Sulfatase" amino acids 237 to 530 (294 residues), 213.2 bits, see alignment E=5.4e-67

Best Hits

KEGG orthology group: K03760, phosphoethanolamine transferase (inferred from 47% identity to spc:Sputcn32_1978)

Predicted SEED Role

"Phosphoethanolamine transferase EptA specific for the 1 phosphate group of core-lipid A" in subsystem Lipid A modifications

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGP2 at UniProt or InterPro

Protein Sequence (548 amino acids)

>HP15_3587 membrane-associated metal-dependent hydrolase (Marinobacter adhaerens HP15)
MHSGTGRFQWPAIKPHWLVLISALALTALYNVPFYTAIDRYVGFDQPMLMFKLAFLLLLV
NHLLISLFSARFILKPVLVFLFLSAALSGYFMNAYGVLIDKHMLQNVFETDVQEARGLLS
LGLLVHMALFFVIPIVLLFLVRMSWPAGLKRVTHWLAPIIVDIALILVLALTSYQEMAST
FRNHRDIKDLVVPVNSVAALASLGSKVAAAQFPQEYQQVGLDATVSLPVSDRTKPNLVVF
VLGETARADHFGLNGYQRNTTPELSKLARQSGGTLVNFPRVSSCGTATALSVPCMFSWLG
RSDYDEAVAKNSDNFLDVMTRSGIVSIWLDNNSGCKGMCDRIPTVRPEDTDLCQGEYCDD
LVLLRGAHQQLDAADNNDHFMVLHQLGSHGPEYYKRSKPDQKKFLPECQSNQLQSCDQQA
IINAYDDSILVTDRLLGETVRMLKSMQADYNTALVYVSDHGESLGEGGIYLHGIPYMLAP
EAQTHVPMVVWLSDGFRMENRIDAECVNRIASQPLSHDNLFSSMLGLMNVKTDAIKPSLN
IFEDCRTT