Protein Info for PGA1_262p00460 in Phaeobacter inhibens DSM 17395

Annotation: transcriptional regulator, MerR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 PF00376: MerR" amino acids 3 to 40 (38 residues), 59.6 bits, see alignment E=3.2e-20 PF13411: MerR_1" amino acids 3 to 69 (67 residues), 72.6 bits, see alignment E=3.5e-24 PF09278: MerR-DNA-bind" amino acids 45 to 108 (64 residues), 75.9 bits, see alignment E=4.7e-25

Best Hits

Swiss-Prot: 45% identical to ZNTR_ECOLI: HTH-type transcriptional regulator ZntR (zntR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 80% identity to dsh:Dshi_3961)

Predicted SEED Role

"Transcriptional regulator, MerR family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ESL3 at UniProt or InterPro

Protein Sequence (142 amino acids)

>PGA1_262p00460 transcriptional regulator, MerR family (Phaeobacter inhibens DSM 17395)
MLTIGTLAKRTGTKVQTIRYYEQIGLMPEPGRTAGGQRRYGHMELDRLAFIRHARQLGFP
LDAIRELLDLADHPGQSCSNADSIAQRQLKQVADRIARLEALQTELQRMICDCAGGTVAE
CRVLEVLRDHSECLTNHNEIGA