Protein Info for PGA1_c03750 in Phaeobacter inhibens DSM 17395

Annotation: succinate dehydrogenase hydrophobic membrane anchor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details PF01127: Sdh_cyt" amino acids 3 to 111 (109 residues), 56.6 bits, see alignment E=1.4e-19 TIGR02968: succinate dehydrogenase, hydrophobic membrane anchor protein" amino acids 16 to 116 (101 residues), 47.8 bits, see alignment E=6.9e-17

Best Hits

Swiss-Prot: 47% identical to DHSD_PARDE: Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) from Paracoccus denitrificans

KEGG orthology group: K00242, succinate dehydrogenase hydrophobic membrane anchor protein (inferred from 64% identity to rde:RD1_1627)

Predicted SEED Role

"Succinate dehydrogenase hydrophobic membrane anchor protein" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DXC4 at UniProt or InterPro

Protein Sequence (123 amino acids)

>PGA1_c03750 succinate dehydrogenase hydrophobic membrane anchor subunit (Phaeobacter inhibens DSM 17395)
MRYLTDRKRAVGMGAAKSGTAHHWSMQVSSIGLLILVPLFVFTFGSALGGSYEEITAYYA
RPFPALVALLTIWVGMMHFKSGAQIMIEDYVHGFAGRLTIILVTCLSYAVAAVSAYALIR
LAL