Protein Info for PGA1_262p00380 in Phaeobacter inhibens DSM 17395
Annotation: sugar transferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 45% identical to EXOY_RHIME: Exopolysaccharide production protein ExoY (exoY) from Rhizobium meliloti (strain 1021)
KEGG orthology group: None (inferred from 63% identity to rde:RD1_3853)MetaCyc: 45% identical to undecaprenyl-phosphate galactose phosphotransferase (Sinorhizobium meliloti 1021)
Undecaprenyl-phosphate galactose phosphotransferase. [EC: 2.7.8.6]
Predicted SEED Role
"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)
MetaCyc Pathways
- Salmonella enterica serotype O:3,10 O antigen biosynthesis (1/5 steps found)
- Porphyromonas gingivalis O-LPS antigen biosynthesis (1/6 steps found)
- Salmonella enterica serotype O:2 O antigen biosynthesis (1/6 steps found)
- Salmonella enterica serotype O:4 O antigen biosynthesis (group B1) (1/6 steps found)
- Salmonella enterica serotype O:9 O antigen biosynthesis (1/6 steps found)
- Salmonella enterica serotype O:9,46 O antigen biosynthesis (1/6 steps found)
- Salmonella enterica serotype O:8 O antigen biosynthesis (1/8 steps found)
- Salmonella enterica serotype O:9,46,27 O antigen biosynthesis (1/9 steps found)
- succinoglycan biosynthesis (1/14 steps found)
Isozymes
Compare fitness of predicted isozymes for: 2.7.8.6
Use Curated BLAST to search for 2.7.8.6
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I7F4F9 at UniProt or InterPro
Protein Sequence (227 amino acids)
>PGA1_262p00380 sugar transferase (Phaeobacter inhibens DSM 17395) MSDVTNFDNPRSPVGCEQAAPRRMGLYAMIGKRLLDILLALILFPVLSPVIALLWMISRR DGGPGFFGHTRIGKDGTPFTCWKIRTMIHGAEDVLAEHLKTDAKAAQEWARDRKLSRDPR ITNLGLFLRRSSLDELPQIWNVLRGDMSFVGPRPIVRCELSKYGSAAPIYLSQKPGITGL WQVSGRNDVSYEDRVSFDIDYLERRTFSFDIKLILLTGLSVIGRTGR