Protein Info for PGA1_262p00360 in Phaeobacter inhibens DSM 17395

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 716 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 313 to 335 (23 residues), see Phobius details PF22673: MCP-like_PDC_1" amino acids 129 to 211 (83 residues), 43.7 bits, see alignment E=7e-15 PF02743: dCache_1" amino acids 139 to 278 (140 residues), 51.3 bits, see alignment E=2.5e-17 PF00672: HAMP" amino acids 334 to 381 (48 residues), 30.1 bits, see alignment 1e-10 PF00015: MCPsignal" amino acids 511 to 661 (151 residues), 149.2 bits, see alignment E=2.3e-47

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 47% identity to sit:TM1040_3177)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ESK4 at UniProt or InterPro

Protein Sequence (716 amino acids)

>PGA1_262p00360 methyl-accepting chemotaxis protein (Phaeobacter inhibens DSM 17395)
MPALFNTISGKLLAATTVAITGLMLCFSVFTALNESKQVRERVLEGASQRASDISQSLSS
QLVEATSAASALGGALSGYIEDGEATTADLIKIMEGVPGRYDLVFSSWMSAIPDGATEDF
ITGTEGRNADGIFAAYWTKSDAGGLNFETFNVDPNDTSEWYRLPIDSGESVITEPYLSNE
NRLLTSVSVPVNAQGQIVGVAGVDIVLDNLGDFIRGLSVYEGGSVMLLGQGGKWLSHPDP
EMLVQAFEGEEVADFQAAIETGEVQIVSDRADGSTRLFYPFTAYGMNKTWVVVLDVPRHV
FVNPVKASIYEQLMTNVLLLGLTLATIFFSVRSLVRRPLGKMLGVMKDLTEGKVHEPVDI
PKRKDEIGAMAASIETLRQGLASKEELEATQLREKQQQEEVVRTLAQQLQQLAGGRLDVK
IHDEMPRQYEALRQDFNNTVEQLSKLITSVNDSADSIDTGLTEIASATNDLSQRTEQSAL
QLEETAASLSELTQNVKHVASGARETEALVTSVSQNAATSSAVARETVDAMDSIAATSEQ
ITRITGMIDDIAFQTNLLALNAGVEAARAGEAGRGFSVVAAEVRSLALRSSESALEIKKL
ITASEAQVAHGVDLVGRTNDSLTTIMNAIGSISEHVGDIAKQADEQSRGISELNGAMSTL
ESAQQQNAAMCEETAAACSSLDHETTNLSRLVTAFQTGERAQPRQVQAQRGYVAAA