Protein Info for Psest_3698 in Pseudomonas stutzeri RCH2

Annotation: Predicted exporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 782 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 254 to 273 (20 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 340 to 364 (25 residues), see Phobius details amino acids 373 to 398 (26 residues), see Phobius details amino acids 420 to 444 (25 residues), see Phobius details amino acids 640 to 657 (18 residues), see Phobius details amino acids 664 to 682 (19 residues), see Phobius details amino acids 688 to 707 (20 residues), see Phobius details amino acids 714 to 737 (24 residues), see Phobius details amino acids 744 to 766 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 57% identity to pfo:Pfl01_0430)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GS10 at UniProt or InterPro

Protein Sequence (782 amino acids)

>Psest_3698 Predicted exporter (Pseudomonas stutzeri RCH2)
MPTEPLQPQRWPAALFCLALLGLLALSAWQWRDGPPLTANLLQLLPSDSHDVLEQLATER
MQEPLKRDLMLLIRHDDEREAQRLTESLAAELRGSGLFAQVRERVQPDLPAVARQLREQS
LGLLDDTERQQLIEHPARFVQQRIKRLYDPFAASPLPLEQDWFGIAGLALQRLPQLGNLR
TGGDGHLIAEHAGQRWAVVHARAQGDAFDERLPQQVAALVETARSAVETAGGELLAAGGV
LHAAHGQRSARAEASLIGSLSLGATLLLLLWLFRTPRILLAALPVLVGALAGAAACVALF
GQMHVLTLVLGASLIGVSLDFPLHYLSKSWTLQPWHGRRALGLILPGLALALLTNLIGYL
ALAFTPFPALTQVAVFSAAGLLGAFLCTTCLLPVLFSGHLTPWPHPLGWAQRWLQLRQAL
LARIATPWLLAGLGLFCLGGVLQLSFKDDLRQWVSRAPLLQQQAERIGTITGFQPTSQYF
LVRAADADALLERQAELSRRLDALQTEQRLGGYLALSQLVAPTAEQARLRPALAQLLAAS
QPLTALGVDVHALRTEIERLQAQPPVTLEAALTGPLGEPWRALWLGKTDDGVAGLISLQG
LRDGAALEQIAEGVPGTTLVDQPARLNQLFAATKLQAGELKLLASLLIFALLCIPFGPGG
ALRCLAVPLLAALASLASLGWLGQSLTLFGLFGLLLVTAIGVDYAILMREQVGGAAVSLV
GTLLAATTTWLSFGLLAVSSTPAVSNFGLTVSLGLAFSFFLAPWAIHQQDTPAQAGRPYG
AA