Protein Info for Psest_3696 in Pseudomonas stutzeri RCH2

Annotation: Predicted thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13279: 4HBT_2
  • amino acids 16 to 123 (108 residues), 39.4 bits, E=7.4e-14
• PF03061: 4HBT
  • amino acids 25 to 90 (66 residues), 32.5 bits, E=8.7e-12

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 76% identity to pmk:MDS_0620)

Predicted SEED Role

"FIG002571: 4-hydroxybenzoyl-CoA thioesterase domain protein"

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

See L0GN54 at UniProt or InterPro

Protein Sequence (141 amino acids)

>Psest_3696 Predicted thioesterase (Pseudomonas stutzeri RCH2)
MRKDGVLQAEVEMLVPFFDVDSMDVVWHGHYVKYFEVARCALLERIGHNYQQMRDAGYAW
PIIDVQLRYMRGARFNQRIVVRADLVEWENRLKINYLIRDAETGERMTRGSTVQVAVEIA
SREMLLASPRVFVDAVERALA