Protein Info for Psest_3693 in Pseudomonas stutzeri RCH2

Annotation: Glycosyltransferases involved in cell wall biogenesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 165 to 173 (9 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 33 to 165 (133 residues), 60.8 bits, see alignment E=8.3e-21

Best Hits

KEGG orthology group: None (inferred from 77% identity to pmk:MDS_0623)

Predicted SEED Role

"FIG143263: Glycosyl transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GS03 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Psest_3693 Glycosyltransferases involved in cell wall biogenesis (Pseudomonas stutzeri RCH2)
MTTLNPLPPVVGQPCTSAMLAPPVEDDWFKPCAVIPVYNHERSLPAVVAALRAADLPCVL
VDDGSCPAAAAVIDELAEQASVFLLRHPRNQGKGGAVISGLREAQRLGFSHALQVDADGQ
HDLSGVELFLDRASQAPDAVICGYPRYDASVPKGRLYARYLTHVWVWINTLSLAIRDSMC
GFRVYPLEPTLALLDRVRLGRRMDFDTEILVRLHWQQQPMVWLPTRVHYPADGVSHFRLW
LDNALISAMHARLFFGMLLRAPKLLARRLQR