Protein Info for PGA1_262p00300 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter, extracellular solute-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00496: SBP_bac_5" amino acids 71 to 441 (371 residues), 298.7 bits, see alignment E=3.5e-93

Best Hits

KEGG orthology group: K02035, peptide/nickel transport system substrate-binding protein (inferred from 48% identity to ddr:Deide_3p00570)

Predicted SEED Role

"Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) or Bacterial Chemotaxis (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F264 at UniProt or InterPro

Protein Sequence (528 amino acids)

>PGA1_262p00300 ABC transporter, extracellular solute-binding protein (Phaeobacter inhibens DSM 17395)
MTRKLVAAAAVLTTALTGPALAQDRGGVLNFARYDGSTLIDPIYADRNPDIWMVGSLFDT
LLHPSQDGNSVVPGLAESYAVSDDGTTVTLTLREGIKFSDGTPLTGEDVVFSLNRARDAD
LSPWAGLLGTLDTVANTGNEITLTLSAPDPTILSMLATFTTGVVSKAWFEAADGATDQEK
SAAIFAAKDAGVGTGPFYLCGFEQGTSMDFCANEHYWRAGADGKPLPYLDGVHFEIIPDD
ATRILKLQAGEMDAAEFIPFSRVAELEADPKIDMNLFPSTRIIYSPINTRPTRADGSANP
LADARVRQALNYATNKKALIGLVLQGAGKPMTSPLMAAATQLATETDPLYGYDMDKAKAL
IAEAGLAAGTEITFTTLAGSADDSTIFAALQQMWAPLGIQLKVEQVDNATRGAKNRSGEF
DIHTYGWVNDVNDPSQVTGWLGYFPTAKAVGTGWENEKFNSLFEASATEMDADSRAGQYA
EMQSIYAEAAPLLFMYETPFAVALSETVSGYVQTPLGNNLFEEASINR