Protein Info for PGA1_262p00170 in Phaeobacter inhibens DSM 17395

Annotation: Predicted branched-chain amino acid permease (azaleucine resistance)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 73 to 98 (26 residues), see Phobius details amino acids 132 to 158 (27 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 200 to 229 (30 residues), see Phobius details PF03591: AzlC" amino acids 22 to 160 (139 residues), 113 bits, see alignment E=7.6e-37

Best Hits

KEGG orthology group: None (inferred from 68% identity to jan:Jann_1523)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E656 at UniProt or InterPro

Protein Sequence (238 amino acids)

>PGA1_262p00170 Predicted branched-chain amino acid permease (azaleucine resistance) (Phaeobacter inhibens DSM 17395)
MTHHTPQRHTASLTQGALAILPLALGASLYGFAFGVLAAQIGFPWWGIATMSGLVHAGSS
QIVAVEQFSSGSALLGAVLAGAALNLRYIGIVASLIPLLDGLPLWKKLLAIHMTGDENWA
LTMAERAKNPQIGAAFLIGSGCVMISVWTLSTALGALVGSSFGDLERFGLGFAFTAAFIA
MARGLWKGTGDLAPWTASFVASFALVVAQVPTAYAIMIGTLTGLAVLLLNPRRKVPAQ