Protein Info for Psest_3678 in Pseudomonas stutzeri RCH2

Annotation: acyl-phosphate glycerol 3-phosphate acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 50 to 70 (21 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 105 to 130 (26 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 160 to 171 (12 residues), see Phobius details TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase" amino acids 4 to 187 (184 residues), 180.2 bits, see alignment E=2.1e-57 PF02660: G3P_acyltransf" amino acids 8 to 181 (174 residues), 176.3 bits, see alignment E=2.7e-56

Best Hits

Swiss-Prot: 79% identical to PLSY_PSEPF: Glycerol-3-phosphate acyltransferase (plsY) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 96% identity to psa:PST_0716)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ73 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Psest_3678 acyl-phosphate glycerol 3-phosphate acyltransferase (Pseudomonas stutzeri RCH2)
MFWLLTLLAYLTGSLSFAILLSRLAGMPDPRAGGSGNPGATNMLRLAGKRLAICTLFGDL
LKGLLPVLLAASLDMSVQQQAWIGLAAVCGHLYPLYFRFRGGKGVATAAGTLLALYPPAA
LLAIVAWLLVFRLTRTSSLAALIALPLCLPLLAWQQPGALLPMSLLATLIVWRHRSNVRD
LFAGRERHF