Protein Info for PGA1_c03720 in Phaeobacter inhibens DSM 17395

Annotation: phosphoglycerate mutase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF00300: His_Phos_1" amino acids 25 to 170 (146 residues), 50.1 bits, see alignment E=1.4e-17

Best Hits

KEGG orthology group: None (inferred from 47% identity to ret:RHE_CH00315)

Predicted SEED Role

"Phosphoglycerate mutase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DLT3 at UniProt or InterPro

Protein Sequence (209 amino acids)

>PGA1_c03720 phosphoglycerate mutase-like protein (Phaeobacter inhibens DSM 17395)
MQLTPQTAIYITHPQVIVDSQVQVTEWQLSPLGAERVDWLAKRVAGLLSTCPVAMVCSAE
RKAIETATPLADALGVDLEQRPHTHENDRSSTGFMPPDAFERQADAFFASPTRSVRGWET
AQAAQVRILREVLAAEADHERRALIICGHGAVGTLLYCALAGLEIDRRWDQPPGGGNWFA
YDRLSRRPLSHWAPIETLFVDQNQSREKQ