Protein Info for Psest_3670 in Pseudomonas stutzeri RCH2

Annotation: bis(5'-nucleosyl)-tetraphosphatase (symmetrical)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 TIGR00668: bis(5'-nucleosyl)-tetraphosphatase (symmetrical)" amino acids 1 to 259 (259 residues), 320.2 bits, see alignment E=6e-100 PF00149: Metallophos" amino acids 1 to 145 (145 residues), 52.3 bits, see alignment E=5.3e-18

Best Hits

Swiss-Prot: 96% identical to APAH_PSEU5: Bis(5'-nucleosyl)-tetraphosphatase, symmetrical (apaH) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01525, bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [EC: 3.6.1.41] (inferred from 96% identity to psa:PST_0724)

Predicted SEED Role

"Bis(5'-nucleosyl)-tetraphosphatase, symmetrical (EC 3.6.1.41)" (EC 3.6.1.41)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GN33 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Psest_3670 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) (Pseudomonas stutzeri RCH2)
MTTYAVGDLQGCLEPLTCLLERVDFSPSRDCLWLAGDLVNRGPQSLEALRFVRELGSSAI
TVLGNHDLHLLAVAHNIERMRKSDTLQSILEAPDRTDLIDWLRQQKLIHYDAPRHTAMVH
AGIPPQWSLEKALKRATEVEQALQDDALLMPFLDGMYGNQPSKWNKELHGVPRLRLITNY
FTRMRFCKADGTLDLEAKEGADSAPAGYAPWFSHANRKTRNVKLIFGHWAALEGQCDEPN
VFALDTGCVWGNAMTLMNLDSGEMHRCECEHGKPA