Protein Info for Psest_3668 in Pseudomonas stutzeri RCH2

Annotation: dimethyladenosine transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF00398: RrnaAD" amino acids 6 to 253 (248 residues), 229.2 bits, see alignment E=2.5e-72 TIGR00755: ribosomal RNA small subunit methyltransferase A" amino acids 6 to 259 (254 residues), 279.6 bits, see alignment E=1.1e-87

Best Hits

Swiss-Prot: 84% identical to RSMA_PSEPK: Ribosomal RNA small subunit methyltransferase A (rsmA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02528, 16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC: 2.1.1.182] (inferred from 94% identity to psa:PST_0726)

Predicted SEED Role

"SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase (EC 2.1.1.182)" (EC 2.1.1.182)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ65 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Psest_3668 dimethyladenosine transferase (Pseudomonas stutzeri RCH2)
MSDYQHRARKRFGQNFLHDAGVIHRILRAIHAKPGERLVEIGPGQGALTEGLLDSGAHLD
VVELDLDLIPILQGKFAERDNFTLHQGDALKFDFSRLSAEPNSLRIVGNLPYNISTPLIF
HLLAHAHLIRDMHFMLQKEVVERLAATPGGGDWGRLSIMVQYHCRVEHLFNVGPGAFNPA
PKVDSAIVRLVPHETLPHPARDHRQLERVVREAFNQRRKTLRNTLKGLLDADAIAAADVD
GSLRPEQLDLAAFVRLSDQLTERS