Protein Info for HP15_3533 in Marinobacter adhaerens HP15

Annotation: response regulator receiver (CheY-like) modulated diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 741 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 250 to 273 (24 residues), see Phobius details PF03924: CHASE" amino acids 74 to 196 (123 residues), 56.5 bits, see alignment E=4.8e-19 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 302 to 463 (162 residues), 115.1 bits, see alignment E=1.4e-37 PF00990: GGDEF" amino acids 306 to 460 (155 residues), 139 bits, see alignment E=1.9e-44 PF00563: EAL" amino acids 481 to 716 (236 residues), 258.9 bits, see alignment E=5.9e-81

Best Hits

KEGG orthology group: None (inferred from 78% identity to maq:Maqu_3786)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PG33 at UniProt or InterPro

Protein Sequence (741 amino acids)

>HP15_3533 response regulator receiver (CheY-like) modulated diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Marinobacter adhaerens HP15)
MLNPLFPVVIFLVFLGLAAGLRYGLVQQDKRQIEANLANEARAMANHLEREFLIHAEAIR
RMAERLETAPDITEQEWRQDARNYLDDFGVYQAIEWIDSDFVIRWLEPFTDNEEVIGYNV
AFNEERRQALELAKQTGTWDLSGVINLRQGGKGMVIYAPVGAGPENNGFMAGVFRMEVLA
RQLLTERVLESFRIEIREAGEVSYQLNVSEPVSSEFSQRQSVNLPTLDWTLTLRPSVEWV
ENQYSDWPALTFTTFLLMGLLTSLTTLLVQLILKRNQALLKTRRELDQEIEQRTAIQKDL
ARLESTDTLTGLANRRFFMEDLSHTLNIADRQMRQVALVMLDLDRFQTLNDSLGHQFGDE
LLIKVSERLNRLSNERLLVAYSGGDEFMFCQQQVDDIDDIIHLLGQIKQCFDQPYEVQGQ
SHSITGTMGVAVYPQSGLDADTLLRNADIALYRAKEQGRNTYQFYTEGMQEREVMRLELD
KDLSQALANNEFVLFYQPQLNLDTGEIQSVEALIRWRHPRRGLLPPVEFIPLAEESGRIT
DIGRWVVMAACRQLAAWKGTPQDGLRIAVNLSGRELDDEDLVDHIREALAAENVPADRLE
VELTEEIFIQNIEHNRNQLSRLHQLGVNLAIDDFGVGYSSLGYLRDFPVDLLKIDRSFIT
EVTERHDDAVITRAVINLAHNLGIQVVAEGVETEEQLSFLKNQRCNFAQGYLISRPIPVD
DLEKALASGVLVAGITADSGL